SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001034990.1.474 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001034990.1.474
Domain Number - Region: 115-188
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0163
Family VPS28 N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001034990.1.474
Sequence length 194
Comment hypothetical protein [Bacillus cereus]; AA=GCF_000293505.1; RF=na; TAX=1053187; STAX=1396; NAME=Bacillus cereus BAG4X2-1; strain=BAG4X2-1; AL=Scaffold; RT=Major
Sequence
MNKKIIWGILGIVVIMIALVSMNVLQKNAKEAEEKKKREASYVQAVAEFYNNIELMGFVA
DFVLPQYSESWSKAIDERRNFNIALNAKKKSLNSMVAQSSVIYSDMEGQLKTVSEAAKEN
PNKYKELYDEYKKMYGIITSLKEQTESPSGTLITFNQNANMLFQEYKKYKGNIDVAISED
IKNEVEKIQEKNKK
Download sequence
Identical sequences A0A1D3PDF8 C2V884
WP_001034990.1.100771 WP_001034990.1.4453 WP_001034990.1.474 WP_001034990.1.55893 WP_001034990.1.75358 WP_001034990.1.84323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]