SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001131900.1.58136 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001131900.1.58136
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Cytochrome c oxidase subunit I-like 1.1e-23
Family Cytochrome c oxidase subunit I-like 0.00000576
Further Details:      
 
Weak hits

Sequence:  WP_001131900.1.58136
Domain Number - Region: 123-162
Classification Level Classification E-value
Superfamily Colicin 0.0575
Family Colicin 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001131900.1.58136
Sequence length 195
Comment hypothetical protein [Shigella flexneri]; AA=GCF_000566185.1; RF=na; TAX=1434162; STAX=623; NAME=Shigella flexneri 2002028; strain=2002028; AL=Scaffold; RT=Major
Sequence
MPLYALGFMGMTRRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMYVSIRDRDQNRD
LTGDPWGGRTLEWATSSPPPFYNFAVVPHVHERDAFWEMKEKGEAYKKPDHYEEIHMPKN
SGAGIVIAAFSTIFGFAMIWHIWWLAIVGFAGMIITWIVKSFDEDVDYYVPVAEIEKLEN
QHFDEITKAGLKNGN
Download sequence
Identical sequences F5NQJ3
WP_001131900.1.41391 WP_001131900.1.58136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]