SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001170969.1.97327 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001170969.1.97327
Domain Number - Region: 39-80
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 0.00523
Family Ribosomal protein L39e 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001170969.1.97327
Sequence length 106
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_001008595.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=B4080; AL=Scaffold; RT=Major
Sequence
MQKLSKKAQIKQDLLQQLENANLNGMHYVDLVDDYITLFDTKNKLAREIKKNGPMIEWQN
SESQKGMKANPATKEFRETNKRMTDLLKVLGLKEPVYDGSNDDDDV
Download sequence
Identical sequences A0A0G8EMK7 A0A1H6D3M8 A0A226R5T4 A0A243F889 A0A243IY94 A0A243JDT5 A0A2H2WAR7 C2NB07 C2XY60 C3DP23 J3U2B9
gi|402560222|ref|YP_006602946.1| WP_001170969.1.10745 WP_001170969.1.19516 WP_001170969.1.2206 WP_001170969.1.27446 WP_001170969.1.29993 WP_001170969.1.43434 WP_001170969.1.44348 WP_001170969.1.5543 WP_001170969.1.7544 WP_001170969.1.75866 WP_001170969.1.75891 WP_001170969.1.76817 WP_001170969.1.81000 WP_001170969.1.97327 WP_001170969.1.97561 WP_001170969.1.99636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]