SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001326076.1.44759 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001326076.1.44759
Domain Number - Region: 30-53
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0194
Family Retrovirus zinc finger-like domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001326076.1.44759
Sequence length 65
Comment hypothetical protein [Escherichia coli]; AA=GCF_001712575.1; RF=na; TAX=1886517; STAX=1886517; NAME=Shigella sp. FC2928; strain=FC2928; AL=Contig; RT=Major
Sequence
MNKNNKTLNNNNMKLIFLKSTLYLLRLSQNQHFDCCCICDAYRHLFIECPKTYFFKAMFF
RYTPL
Download sequence
Identical sequences A0A2G9BGR8
WP_001326076.1.101186 WP_001326076.1.10491 WP_001326076.1.14914 WP_001326076.1.15420 WP_001326076.1.1561 WP_001326076.1.17757 WP_001326076.1.17984 WP_001326076.1.18118 WP_001326076.1.1982 WP_001326076.1.20737 WP_001326076.1.22060 WP_001326076.1.22885 WP_001326076.1.24362 WP_001326076.1.27797 WP_001326076.1.31433 WP_001326076.1.34532 WP_001326076.1.38911 WP_001326076.1.44724 WP_001326076.1.44759 WP_001326076.1.47344 WP_001326076.1.48111 WP_001326076.1.56502 WP_001326076.1.57266 WP_001326076.1.57492 WP_001326076.1.58692 WP_001326076.1.62481 WP_001326076.1.63466 WP_001326076.1.64138 WP_001326076.1.65366 WP_001326076.1.66933 WP_001326076.1.69569 WP_001326076.1.69872 WP_001326076.1.7102 WP_001326076.1.71912 WP_001326076.1.76815 WP_001326076.1.77253 WP_001326076.1.77657 WP_001326076.1.80071 WP_001326076.1.82901 WP_001326076.1.8295 WP_001326076.1.83238 WP_001326076.1.86609 WP_001326076.1.86753 WP_001326076.1.87694 WP_001326076.1.8879 WP_001326076.1.89069 WP_001326076.1.89915 WP_001326076.1.93312 WP_001326076.1.95332 WP_001326076.1.97962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]