SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001575475.1.958 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001575475.1.958
Domain Number - Region: 21-64
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00745
Family BCR-homology GTPase activation domain (BH-domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001575475.1.958
Sequence length 70
Comment MULTISPECIES: hypothetical protein [Enterobacterales]; AA=GCF_001472155.1; RF=na; TAX=548; STAX=548; NAME=Klebsiella aerogenes; strain=SMART_350; AL=Contig; RT=Major
Sequence
MADYNSFVLEGIKIIFADNNKEFIKEICEPLINILCIEEYYSATGIYNYDDADEQTELLK
NALRDYKMAH
Download sequence
Identical sequences A0A2J5DE58
WP_001575475.1.100796 WP_001575475.1.14239 WP_001575475.1.16805 WP_001575475.1.17242 WP_001575475.1.19749 WP_001575475.1.20009 WP_001575475.1.24210 WP_001575475.1.24899 WP_001575475.1.25087 WP_001575475.1.30098 WP_001575475.1.35045 WP_001575475.1.37092 WP_001575475.1.40147 WP_001575475.1.47478 WP_001575475.1.48970 WP_001575475.1.52002 WP_001575475.1.52656 WP_001575475.1.54185 WP_001575475.1.54625 WP_001575475.1.56299 WP_001575475.1.56389 WP_001575475.1.58384 WP_001575475.1.60597 WP_001575475.1.64556 WP_001575475.1.66050 WP_001575475.1.75837 WP_001575475.1.79495 WP_001575475.1.81254 WP_001575475.1.81484 WP_001575475.1.83897 WP_001575475.1.85180 WP_001575475.1.88526 WP_001575475.1.88646 WP_001575475.1.91572 WP_001575475.1.91599 WP_001575475.1.92372 WP_001575475.1.94597 WP_001575475.1.958 WP_001575475.1.96176 WP_001575475.1.96919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]