SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001744739.1.64330 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001744739.1.64330
Domain Number - Region: 69-115
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0741
Family DBL homology domain (DH-domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001744739.1.64330
Sequence length 158
Comment MULTISPECIES: hypothetical protein [Enterobacteriaceae]; AA=GCF_000498875.2; RF=na; TAX=1389416; STAX=562; NAME=Escherichia coli LAU-EC5; strain=LAU-EC5; AL=Contig; RT=Minor
Sequence
MHKSENEKIDFILDEHERISRKQGSLCMALGKGFLVIAILCGVATFCVSGLYLKSLCLSV
ACCCGVFSRIFNYYSVPEESRRVLSRQELLWLMSLTEDCPDMHQELLNCLLSGKKLTGLD
KREIRSLWWEKMDAMQESATRQREQDTIRQFSEESKSE
Download sequence
Identical sequences A0A2B7M781 V8JYD7
WP_001744739.1.100066 WP_001744739.1.101769 WP_001744739.1.11071 WP_001744739.1.13672 WP_001744739.1.32709 WP_001744739.1.32831 WP_001744739.1.41539 WP_001744739.1.42095 WP_001744739.1.51542 WP_001744739.1.59853 WP_001744739.1.64330 WP_001744739.1.83820 WP_001744739.1.96894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]