SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001949310.1.17107 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001949310.1.17107
Domain Number 1 Region: 40-156
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.82e-16
Family G proteins 0.021
Further Details:      
 
Weak hits

Sequence:  WP_001949310.1.17107
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.017
Family IP3 receptor type 1 binding core, domain 2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001949310.1.17107
Sequence length 160
Comment hypothetical protein [Helicobacter pylori]; AA=GCF_000345365.2; RF=na; TAX=1159042; STAX=210; NAME=Helicobacter pylori GAM252T; strain=GAM252T; AL=Scaffold; RT=Minor
Sequence
MNETLEQFKRNQKRNQEILKKLLDFVHTGEEYGIKVEESLKDKIHNAMENVGGQKLKVAL
VGGFSCGKTSIAAAWIERLDKSMKIDHQESSDEVKNYHIDDEIELVDTPGLFGFKVKEHD
SGKIERYKDITKKYISEAHLILYALNPSNPIKESHKDDLN
Download sequence
Identical sequences M3TIB9
WP_001949310.1.17107 WP_001949310.1.24769 WP_001949310.1.26026 WP_001949310.1.2746 WP_001949310.1.28876 WP_001949310.1.30174 WP_001949310.1.3425 WP_001949310.1.39102 WP_001949310.1.4080 WP_001949310.1.62964 WP_001949310.1.73394 WP_001949310.1.79497 WP_001949310.1.84887 WP_001949310.1.98736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]