SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002002296.1.782 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002002296.1.782
Domain Number - Region: 11-70
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00392
Family DBL homology domain (DH-domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002002296.1.782
Sequence length 89
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000832385.1; RF=na; TAX=1454382; STAX=1396; NAME=Bacillus cereus D17; strain=D17; AL=Complete Genome; RT=Major
Sequence
MKVQYNVLEQLIKSLSALSPEKEREIVAVDLHDIYESAERFEKILENIMDSQHSKEDLID
ALIEVEIELDHINWHYKSLKKKLKILMKD
Download sequence
Identical sequences A0A1T3UY58 A0A243BHV3 A0RAZ6 C2NED6 C3FZN0
WP_002002296.1.13221 WP_002002296.1.14882 WP_002002296.1.16013 WP_002002296.1.17424 WP_002002296.1.23873 WP_002002296.1.24676 WP_002002296.1.25316 WP_002002296.1.26000 WP_002002296.1.29804 WP_002002296.1.33828 WP_002002296.1.35255 WP_002002296.1.3699 WP_002002296.1.41365 WP_002002296.1.45919 WP_002002296.1.46476 WP_002002296.1.4649 WP_002002296.1.49831 WP_002002296.1.56580 WP_002002296.1.59978 WP_002002296.1.62300 WP_002002296.1.63137 WP_002002296.1.69970 WP_002002296.1.782 WP_002002296.1.7856 WP_002002296.1.90155 WP_002002296.1.95308 WP_002002296.1.99454 gi|118476745|ref|YP_893896.1| 412694.BALH_1025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]