SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002063807.1.50411 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002063807.1.50411
Domain Number 1 Region: 31-299
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 1.44e-57
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000613
Further Details:      
 
Weak hits

Sequence:  WP_002063807.1.50411
Domain Number - Region: 9-37
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0837
Family Trimerization domain of TRAF 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002063807.1.50411
Sequence length 314
Comment chemotaxis protein [Bacillus cereus]; AA=GCF_000293705.1; RF=na; TAX=1053201; STAX=1396; NAME=Bacillus cereus HuA2-1; strain=HuA2-1; AL=Scaffold; RT=Major
Sequence
MFTQKKALQHKIDQLENRIQELETELKQKDIESQETISSIHDRVQSVVQEHQLVNNQHHT
LQNLIQQLNSCFENVSTRTTHSNELNSEMLQKEQSLIQSIEEIIDCSNEGKESVHRLLIV
INKLGEQSQRTSNSMNHLSERSKEIEQIVEVIQNIAAQTNLLALNASIEAARAGEHGKGF
AVVANEVRKLAESTAESTKNIGNLTKKIQEEIEKAYENTKDNLHLVDEGVEMSADTNARI
ENILIMIQTLQSGATNVIKAIENQKSCNDDILREFANTQQMFQKLNTTIMSHIHDAEKVD
VQLTKGLQETVSSH
Download sequence
Identical sequences C2XPH6 J8I4M2 J9CUA7 R8CJC1 R8CRA3
WP_002063807.1.39317 WP_002063807.1.50411 WP_002063807.1.6426 WP_002063807.1.68668 WP_002063807.1.75292 WP_002063807.1.76817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]