SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002088134.1.85187 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002088134.1.85187
Domain Number - Region: 14-66
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0785
Family Insect pheromone/odorant-binding proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002088134.1.85187
Sequence length 94
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_000291315.1; RF=na; TAX=1053199; STAX=1396; NAME=Bacillus cereus CER074; strain=CER074; AL=Scaffold; RT=Major
Sequence
MTHKYDRLHDLVLPGDFSFANKLHNCMVACIHNMFYAKSAEESNHWEEELERCMKEFKML
RDTKEEHEASMSYRVVIKDLRARGVNASLVTRRK
Download sequence
Identical sequences A0A1D3MR57 J7TFS6
WP_002088134.1.23136 WP_002088134.1.27729 WP_002088134.1.4354 WP_002088134.1.52845 WP_002088134.1.84599 WP_002088134.1.85187 WP_002088134.1.87416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]