SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002194192.1.6340 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002194192.1.6340
Domain Number 1 Region: 74-208
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.11e-17
Family Ribonuclease H 0.0098
Further Details:      
 
Weak hits

Sequence:  WP_002194192.1.6340
Domain Number - Region: 15-73
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0706
Family Multimerization domain of the phosphoprotein from sendai virus 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002194192.1.6340
Sequence length 219
Comment hypothetical protein [Bacillus cereus]; AA=GCF_002117465.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=BC-AK; AL=Chromosome; RT=Major
Sequence
MKYKIHWLYKTKRGLQTDLTTDYMNIEEVLQFAEDFEKTGRVKELLFYDEMDAEWSLKEM
KKLNKQVEEEAQEILVYFDGGYDAQTKEAGVGICVYYKKGNKNYRIRRNAYIEGIYDNNE
AEYASLLYSMNILEELGIKYEVVTLRGDSQVVLQQLAGEWPCYDEHLNHYLDQIEQKAKQ
MKLKLVCEPISRKQNKEAHQLATQALEGTVIDSHKEITE
Download sequence
Identical sequences A0A2B3Y424 A0A2H2X9N3
WP_002194192.1.28913 WP_002194192.1.31503 WP_002194192.1.51335 WP_002194192.1.6340 WP_002194192.1.7398 WP_002194192.1.7628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]