SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002734897.1.56917 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002734897.1.56917
Domain Number - Region: 22-52
Classification Level Classification E-value
Superfamily 39 kda initiator binding protein, IBP39, C-terminal domains 0.00863
Family 39 kda initiator binding protein, IBP39, C-terminal domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002734897.1.56917
Sequence length 84
Comment MULTISPECIES: hypothetical protein [Leptospira]; AA=GCF_000347195.1; RF=na; TAX=1242991; STAX=1242990; NAME=Leptospira sp. serovar Kenya str. Sh9; strain=Sh9; AL=Contig; RT=Major
Sequence
MKETQYLTPYGSFDRGRLSPSVLRRLSIVGYDNNNNTWITYDPYGDKNQANYGKQGLTVG
RAVEYGQNTNGIGDRRIYWMEDKK
Download sequence
Identical sequences M6E4F2
WP_002734897.1.100408 WP_002734897.1.11109 WP_002734897.1.15257 WP_002734897.1.15764 WP_002734897.1.16921 WP_002734897.1.18256 WP_002734897.1.47267 WP_002734897.1.51771 WP_002734897.1.56917 WP_002734897.1.69722 WP_002734897.1.84953 WP_002734897.1.93348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]