SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002786782.1.40961 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002786782.1.40961
Domain Number - Region: 9-41
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.00759
Family Trimerization domain of TRAF 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002786782.1.40961
Sequence length 85
Comment MULTISPECIES: hypothetical protein [Campylobacter]; AA=GCF_001765195.1; RF=na; TAX=195; STAX=195; NAME=Campylobacter coli; strain=BCW_5137; AL=Scaffold; RT=Major
Sequence
MFLIFKKNEKIRNLEKEVQRLKGVIALKDTAINEISLKLEEEIKINVKLSNFRIKILDAL
GLIGVKNNDEIAIKEVKRLKEKECQ
Download sequence
Identical sequences WP_002786782.1.101225 WP_002786782.1.14048 WP_002786782.1.20561 WP_002786782.1.40961 WP_002786782.1.46004 WP_002786782.1.61907 WP_002786782.1.6756 WP_002786782.1.69937 WP_002786782.1.74900 WP_002786782.1.85240 WP_002786782.1.88778 WP_002786782.1.93287 WP_002786782.1.9772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]