SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002800839.1.81551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002800839.1.81551
Domain Number - Region: 9-41
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.00288
Family Trimerization domain of TRAF 0.0059
Further Details:      
 
Domain Number - Region: 39-73
Classification Level Classification E-value
Superfamily Lp2179-like 0.0235
Family Lp2179-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002800839.1.81551
Sequence length 85
Comment MULTISPECIES: hypothetical protein [Campylobacter]; AA=GCF_001490795.1; RF=na; TAX=195; STAX=195; NAME=Campylobacter coli; AL=Contig; RT=Major
Sequence
MFLIFKKNEKIRNLEKEVQRLKGVIALKDTAINEMSLKFEEEIKINVELSNFRIKILDAL
GLIGVFKNDDKAIKEVKRLKEKECQ
Download sequence
Identical sequences WP_002800839.1.12878 WP_002800839.1.25099 WP_002800839.1.32162 WP_002800839.1.35148 WP_002800839.1.37037 WP_002800839.1.38315 WP_002800839.1.47906 WP_002800839.1.64179 WP_002800839.1.71776 WP_002800839.1.75600 WP_002800839.1.76022 WP_002800839.1.80652 WP_002800839.1.81030 WP_002800839.1.81551 WP_002800839.1.95773 WP_002800839.1.96104 WP_002800839.1.96527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]