SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002843674.1.42831 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002843674.1.42831
Domain Number - Region: 27-66
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.000811
Family Multimerization domain of the phosphoprotein from sendai virus 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002843674.1.42831
Sequence length 88
Comment hypothetical protein [Peptostreptococcus anaerobius]; AA=GCF_000178095.1; RF=na; TAX=596329; STAX=1261; NAME=Peptostreptococcus anaerobius 653-L; strain=653-L; AL=Contig; RT=Major
Sequence
MIEVKKKLFPVSIIAVGIGAFAISIFNRNKLKNLEDEVKSTRDDVKSILCYQEQKNALIE
SELEDMRNEVASCYEHFEVFSKEKEDGR
Download sequence
Identical sequences D3MRQ1
WP_002843674.1.42831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]