SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002849949.1.38168 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002849949.1.38168
Domain Number - Region: 190-263
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0157
Family Multimerization domain of the phosphoprotein from sendai virus 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002849949.1.38168
Sequence length 325
Comment hypothetical protein [Campylobacter fetus]; AA=GCF_000759515.1; RF=na; TAX=1093099; STAX=196; NAME=Campylobacter fetus subsp. venerealis 97/608; strain=97/608; AL=Complete Genome; RT=Major
Sequence
MENNENLHDDNKTTNENAPVKTLESKDEIIARLESEAARAKDELENVEQGKKELQDKLER
LIYERNMTAQILRDEVAELSSKFEKAGLKISEKGVISVLDYSNYQKRVTIAFNMFDSDLN
MLLKTINRIGEENNADYSNHTKRVENLLDESVKLRQLFDYLNEFILNPPSKEFMALMNNT
LGIRKIAQDYKEFQNLADITKIKVSMQEQENVFNEMVSKFDSFAINQNKFFEDELNKIEN
FKGKINARLNDTGDEYKRFSENMISNLNDQLKVFEINLAEYKEIREKEVKLLSKLKKGGY
ALTGLLFLLCLALGGVVGYAISLVK
Download sequence
Identical sequences B2CG30 W0D7T9
WP_002849949.1.1289 WP_002849949.1.17016 WP_002849949.1.38168 WP_002849949.1.39057 WP_002849949.1.42882 WP_002849949.1.5603 WP_002849949.1.62614 WP_002849949.1.68475 WP_002849949.1.77394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]