SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002920121.1.87281 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002920121.1.87281
Domain Number - Region: 66-113
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0116
Family IP3 receptor type 1 binding core, domain 2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002920121.1.87281
Sequence length 158
Comment hypothetical protein [Campylobacter jejuni]; AA=GCF_000254515.1; RF=na; TAX=889247; STAX=197; NAME=Campylobacter jejuni subsp. jejuni ATCC 33560; strain=ATCC 33560; AL=Contig; RT=Major
Sequence
MKHCLALCFIFFLCACSVKNQNFSSQSLMVLIASPMIKINDAAFLKKENNALNLEVYKLG
QAFFELKIKDKICINAVCYDKQVFNQKFFKNVYYDDILSDILKANALWQGKNLEKTDCGF
EQNLKAKNYEIFYQVCDNKVSFFDKISHTKIILTHIQN
Download sequence
Identical sequences A0A1J6PWW2
WP_002920121.1.11471 WP_002920121.1.17614 WP_002920121.1.22810 WP_002920121.1.26385 WP_002920121.1.30838 WP_002920121.1.3984 WP_002920121.1.44197 WP_002920121.1.44556 WP_002920121.1.44860 WP_002920121.1.5922 WP_002920121.1.62996 WP_002920121.1.71156 WP_002920121.1.79201 WP_002920121.1.7977 WP_002920121.1.80139 WP_002920121.1.80796 WP_002920121.1.87281 WP_002920121.1.88917 WP_002920121.1.89641 WP_002920121.1.90347 WP_002920121.1.94769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]