SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003027119.1.86448 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003027119.1.86448
Domain Number - Region: 4-29
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00188
Family Biotin repressor-like 0.075
Further Details:      
 
Domain Number - Region: 96-121
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0942
Family Trimerization domain of TRAF 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003027119.1.86448
Sequence length 164
Comment MULTISPECIES: hypothetical protein [Streptococcus]; AA=GCF_001838535.1; RF=na; TAX=1739287; STAX=1739287; NAME=Streptococcus sp. HMSC034F03; strain=HMSC034F03; AL=Scaffold; RT=Major
Sequence
MAIEKTVSELAEILGISRQAMNNRVKTLAPEDTDKNEKGVTVVTRSGLIKLEEIYKKTIF
EDEPVSEDVKQRELMEILVDEKNAEIVRLYDQLKAKDAQLAKKDEQLRVKDVQIAEKDKQ
LDQQQQLTAKAMSERETLLLELDEAKEKVQAQEQKGFFARLFGR
Download sequence
Identical sequences A0A0E9FGR3 A0A1F0RGK8 A0A1S1FAJ0 A0A1S1FE82 A0A2I1UT53 W1TX54
WP_003027119.1.24156 WP_003027119.1.28726 WP_003027119.1.43030 WP_003027119.1.43933 WP_003027119.1.45477 WP_003027119.1.46706 WP_003027119.1.58363 WP_003027119.1.76695 WP_003027119.1.82055 WP_003027119.1.85432 WP_003027119.1.86448 WP_003027119.1.88804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]