SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003185460.1.94809 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003185460.1.94809
Domain Number 1 Region: 139-427
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.81e-131
Family Enolase 0.00000000263
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.34e-61
Family Enolase N-terminal domain-like 0.00000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003185460.1.94809
Sequence length 430
Comment MULTISPECIES: enolase [Bacillus]; AA=GCF_000260555.1; RF=na; TAX=1169411; STAX=1402; NAME=Bacillus licheniformis 10-1-A; strain=10-1-A; AL=Contig; RT=Major
Sequence
MPYIVDVYAREVLDSRGNPTVEVEVYTESGAFGRALVPSGASTGEYEAVELRDGDKDRYL
GKGVLTAVNNVNEIIAPELIGFDVTEQVSIDKLLIELDGTENKGKLGANAILGVSMAVAR
AAADFLQIPLYQYLGGFNSKTLPVPMMNIVNGGEHADNNVDIQEFMIMPVGAENFREALR
MGAQIFHSLKSVLKEKGLNTAVGDEGGFAPNLGSNEEALQTIVEAIEKAGFKPGEEVKLA
MDAASSEFYNKEDGKYHLAGEGVVKTSAEMVDWYEELTSKYPIISIEDGLDENDWEGHKL
LTERLGSKVQLVGDDLFVTNTKKLAEGIKNGVGNSILIKVNQIGTLTETFDAIEMAKRAG
YTAVISHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLAETAQYH
GIQSFYNLNK
Download sequence
Identical sequences A0A1Y0YSR3 Q65EN2
gi|404490839|ref|YP_006714945.1| WP_003185460.1.10695 WP_003185460.1.12567 WP_003185460.1.1290 WP_003185460.1.20727 WP_003185460.1.21456 WP_003185460.1.22930 WP_003185460.1.27377 WP_003185460.1.27603 WP_003185460.1.27836 WP_003185460.1.31090 WP_003185460.1.31877 WP_003185460.1.34504 WP_003185460.1.34863 WP_003185460.1.34956 WP_003185460.1.35726 WP_003185460.1.35764 WP_003185460.1.42641 WP_003185460.1.46361 WP_003185460.1.46635 WP_003185460.1.47006 WP_003185460.1.48016 WP_003185460.1.50447 WP_003185460.1.54544 WP_003185460.1.57471 WP_003185460.1.62441 WP_003185460.1.62618 WP_003185460.1.64701 WP_003185460.1.70162 WP_003185460.1.719 WP_003185460.1.71919 WP_003185460.1.7403 WP_003185460.1.74244 WP_003185460.1.8120 WP_003185460.1.85389 WP_003185460.1.8660 WP_003185460.1.86740 WP_003185460.1.86759 WP_003185460.1.94809 WP_003185460.1.9500 WP_003185460.1.95031 WP_003185460.1.9558 WP_003185460.1.96953 WP_003185460.1.98374 WP_003185460.1.99505 gi|52081958|ref|YP_080749.1| 279010.BL03468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]