SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003357910.1.66957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003357910.1.66957
Domain Number - Region: 17-47
Classification Level Classification E-value
Superfamily Phenylalanine zipper 0.0144
Family Adapter protein APS, dimerisation domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_003357910.1.66957
Sequence length 60
Comment putative bacteriocin precursor [Clostridium botulinum]; AA=GCF_001879605.1; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=CDC_69094; AL=Complete Genome; RT=Major
Sequence
MKKLTKKLNFKSDTVEAYCECHANCSCYQVCGAARNFKANNLNDSNWDGRTMSAEMRSYE
Download sequence
Identical sequences A0A2I4N377 M1ZWD6
WP_003357910.1.101508 WP_003357910.1.10598 WP_003357910.1.14220 WP_003357910.1.16702 WP_003357910.1.17634 WP_003357910.1.25111 WP_003357910.1.26119 WP_003357910.1.28409 WP_003357910.1.36784 WP_003357910.1.50688 WP_003357910.1.50747 WP_003357910.1.52140 WP_003357910.1.52741 WP_003357910.1.56340 WP_003357910.1.61167 WP_003357910.1.64959 WP_003357910.1.65258 WP_003357910.1.65765 WP_003357910.1.66957 WP_003357910.1.67470 WP_003357910.1.69035 WP_003357910.1.80865 WP_003357910.1.8456 WP_003357910.1.87449 WP_003357910.1.88000 WP_003357910.1.92266 WP_003357910.1.93526 WP_003357910.1.96382 WP_003357910.1.96844 WP_003357910.1.9927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]