SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003361941.1.97020 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003361941.1.97020
Domain Number 1 Region: 8-140
Classification Level Classification E-value
Superfamily AF1862-like 5.23e-32
Family Cas Cmr5-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003361941.1.97020
Sequence length 149
Comment type III-B CRISPR module-associated protein Cmr5 [Clostridium botulinum]; AA=GCF_001951135.2; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=CDC_69096; AL=Chromosome; RT=Major
Sequence
MYQTINIKDLKRKKASFAFNAIEYIQSSGDKKFKGYIRNIPMYIYTNGLIATIAFILKKM
GTEYEREKGTDKQSYYEIGEILRDYFNKDFIEYDDKFKEKSLEDIMKELIKCDSKSYRRI
TLDILSILEWLVRFSDAMLEGEGESSEPI
Download sequence
Identical sequences gi|237795595|ref|YP_002863147.1| WP_003361941.1.28306 WP_003361941.1.34328 WP_003361941.1.49727 WP_003361941.1.97020 515621.CLJ_B2379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]