SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003397789.1.31450 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_003397789.1.31450
Domain Number - Region: 28-82
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.00275
Family Multimerization domain of the phosphoprotein from sendai virus 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003397789.1.31450
Sequence length 87
Comment MULTISPECIES: hypothetical protein [Anoxybacillus]; AA=GCF_000753875.1; RF=na; TAX=1535751; STAX=1535751; NAME=Anoxybacillus sp. KU2-6(11); strain=KU2-6(11); AL=Contig; RT=Major
Sequence
MATRQSMDEFLQHCEDVLRYAKEQYTEASKLEHYNDTEYVKAQQMLEHAVTDLAHFSLSC
NAQQREQLHRMRLQLEQLQNDMILLRH
Download sequence
Identical sequences A0A094IY20 A0A094JRR0 A0A0A2T0W0 A0A0B0HLF9 A0A0D0HMY6 A0A0D0Q7T0 A0A0K6GJR9 A0A1V3FM34 M5QVK9 M8DMI0
WP_003397789.1.12655 WP_003397789.1.13911 WP_003397789.1.15443 WP_003397789.1.15876 WP_003397789.1.19181 WP_003397789.1.19270 WP_003397789.1.1944 WP_003397789.1.19913 WP_003397789.1.25555 WP_003397789.1.31030 WP_003397789.1.31450 WP_003397789.1.34884 WP_003397789.1.5075 WP_003397789.1.60958 WP_003397789.1.68149 WP_003397789.1.70975 WP_003397789.1.72693 WP_003397789.1.74080 WP_003397789.1.74406 WP_003397789.1.82098 WP_003397789.1.83661 WP_003397789.1.92136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]