SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_003815495.1.37794 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_003815495.1.37794
Domain Number 1 Region: 117-374
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.36e-72
Family D-glucarate dehydratase-like 0.00019
Further Details:      
 
Domain Number 2 Region: 1-131
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.24e-28
Family Enolase N-terminal domain-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_003815495.1.37794
Sequence length 387
Comment MULTISPECIES: mandelate racemase [Bordetella]; AA=GCF_000690295.1; RF=na; TAX=1331221; STAX=518; NAME=Bordetella bronchiseptica MBORD624; strain=MBORD624; AL=Contig; RT=Major
Sequence
MKITEVKAHALSTPIPERMRVESGAGLKLNRQMILVEVRTDEGVTGVGSPSGPYDLAVLK
RAIEDVIGPQLIGEDPANINYLWHKVFHGEVSRNLGHRSVGIAAMSGVDIALWDLKGRAM
NQPIYQLLGGKFHTRGVRAYASSIYWDLTPDQAADELAGWVEQGFTAAKLKVGRAPRKDA
ANLRAMRQRVGADVEILVDANQSLGRHDALAMLRILDEAGCYWFEEPLSIDDIEGHRILR
AQGTPVRIATGENLYTRNAFNDYIRNDAIDVLQADASRAGGITEALAISASAASAHLAWN
PHTFNDIITVAANLHLVAASPHPAMFEWDITHNDLMTRLASYDLKLENGLVQPPQGPGLG
FEIDWDFVAAHAWKGEPAIGAGHGMKK
Download sequence
Identical sequences A0A063URZ8 A0A0C6P7W7 A0A0H3LT39 A0A1M8HFB6 K0MJM9
gi|410474731|ref|YP_006898012.1| gi|33603659|ref|NP_891219.1| gi|412341018|ref|YP_006969773.1| WP_003815495.1.14246 WP_003815495.1.15674 WP_003815495.1.1660 WP_003815495.1.17334 WP_003815495.1.17359 WP_003815495.1.19828 WP_003815495.1.20111 WP_003815495.1.21837 WP_003815495.1.24339 WP_003815495.1.29688 WP_003815495.1.30681 WP_003815495.1.31572 WP_003815495.1.32589 WP_003815495.1.37794 WP_003815495.1.38534 WP_003815495.1.40806 WP_003815495.1.50287 WP_003815495.1.54628 WP_003815495.1.57255 WP_003815495.1.58338 WP_003815495.1.63299 WP_003815495.1.63717 WP_003815495.1.64622 WP_003815495.1.65401 WP_003815495.1.66177 WP_003815495.1.69310 WP_003815495.1.71104 WP_003815495.1.71382 WP_003815495.1.71489 WP_003815495.1.72041 WP_003815495.1.72199 WP_003815495.1.82663 WP_003815495.1.84958 WP_003815495.1.84976 WP_003815495.1.86585 WP_003815495.1.87218 WP_003815495.1.88542 WP_003815495.1.91389 WP_003815495.1.93987 YP_006898012.1.34978 YP_006969773.1.84680 NYSGXRC-9280a 257310.BB4687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]