SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004080723.1.45724 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004080723.1.45724
Domain Number 1 Region: 6-154
Classification Level Classification E-value
Superfamily Hypothetical protein TM0875 3.14e-95
Family Hypothetical protein TM0875 0.0000000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004080723.1.45724
Sequence length 158
Comment hypothetical protein [Thermotoga maritima]; AA=GCF_000978575.1; RF=na; TAX=2336; STAX=2336; NAME=Thermotoga maritima; strain=Tma100; AL=Complete Genome; RT=Major
Sequence
MRLMDILEILYYKKGKEFGILEKKMKEIFNETGVSLEPVNSELIGRIFLKISVLEEGEEV
PSFAIKALTPKENAVDLPLGDWTDLKNVFVEEIDYLDSYGDMKILSEKNWYKIYVPYSSV
KKKNRNELVEEFMKYFFESKGWNPGEYTFSVQEIDNLF
Download sequence
Identical sequences Q9WZX8 R4NZN9
243274.TM0875 gi|15643637|ref|NP_228683.1| 282744 APC4447 gi|15643637|ref|NP_228683.1| NP_228683.1.35502 WP_004080723.1.29620 WP_004080723.1.45724 WP_004080723.1.51363 WP_004080723.1.56403 WP_004080723.1.79805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]