SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004085416.1.63667 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004085416.1.63667
Domain Number 1 Region: 145-260
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000399
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Weak hits

Sequence:  WP_004085416.1.63667
Domain Number - Region: 44-89
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.051
Family Multimerization domain of the phosphoprotein from sendai virus 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_004085416.1.63667
Sequence length 271
Comment tol-pal system protein YbgF [Xylella fastidiosa]; AA=GCF_000466025.1; RF=na; TAX=1343737; STAX=2371; NAME=Xylella fastidiosa subsp. multiplex Griffin-1; strain=Griffin-1; AL=Contig; RT=Major
Sequence
MRLGGSTFCVVAMALGTVAPSSAQMSSLADRVMALEQRASDPQVNIDLINQINDLRSQIR
QMQGSIEEMQHGYEQLKQQSKDQYLDLDSRLKPIESGSVREPSRVPANPISQVSPSHSNQ
PIAMSEQSPNVHGDASALTISNEERIAYNVAFDALKNSKYADAAELFISFLQLYPNGVYT
PNAIYWLGESYYAMHDFVSAEAQFRSLLSRYPTHDKASGSLLKEALCQANQGKNDDAQHS
LEQVLSQYPGTDAARLAQERLQSMKLSQAMR
Download sequence
Identical sequences A0A1R2D6D2 Q3REN4
gi|170730226|ref|YP_001775659.1| WP_004085416.1.28558 WP_004085416.1.34418 WP_004085416.1.34606 WP_004085416.1.35854 WP_004085416.1.45638 WP_004085416.1.46267 WP_004085416.1.530 WP_004085416.1.63667 405440.Xfasm12_1070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]