SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004399476.1.56411 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_004399476.1.56411
Domain Number - Region: 7-42
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0565
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004399476.1.56411
Sequence length 44
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_001697265.1; RF=na; TAX=135461; STAX=1423; NAME=Bacillus subtilis subsp. subtilis; strain=KCTC 3135; AL=Complete Genome; RT=Major
Sequence
MKMKYGLYCMGSLVNTYDDAIEAHNDAVYAQEESGVPHEVREIQ
Download sequence
Identical sequences A0A0A1M4L9 A0A0K6KSM1 A0A2C6F1H5 O31880 O64168
O64168_BPSPB gi|470162207|ref|YP_007533982.1| NP_046708.1.20604 NP_389893.1.22788 WP_004399476.1.11257 WP_004399476.1.1140 WP_004399476.1.14761 WP_004399476.1.15902 WP_004399476.1.16291 WP_004399476.1.2914 WP_004399476.1.30885 WP_004399476.1.32420 WP_004399476.1.33846 WP_004399476.1.36189 WP_004399476.1.40859 WP_004399476.1.44184 WP_004399476.1.45019 WP_004399476.1.47157 WP_004399476.1.56274 WP_004399476.1.56411 WP_004399476.1.57156 WP_004399476.1.57201 WP_004399476.1.5726 WP_004399476.1.57513 WP_004399476.1.6517 WP_004399476.1.65223 WP_004399476.1.72999 WP_004399476.1.76977 WP_004399476.1.81116 WP_004399476.1.81747 WP_004399476.1.88382 WP_004399476.1.91723 WP_004399476.1.93420 WP_004399476.1.93618 WP_004399476.1.94199 WP_004399476.1.96043 WP_004399476.1.979 224308.BSU20110 gi|9630281|ref|NP_046708.1| gi|16079070|ref|NP_389893.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]