SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_004717823.1.3694 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_004717823.1.3694
Domain Number 1 Region: 105-232
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000235
Family BCR-homology GTPase activation domain (BH-domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_004717823.1.3694
Sequence length 278
Comment hypothetical protein [Yersinia ruckeri]; AA=GCF_001880355.1; RF=na; TAX=29486; STAX=29486; NAME=Yersinia ruckeri; strain=88/3873; AL=Contig; RT=Major
Sequence
MGINFLTKSNSYYIGQESKWVKTKNAKDQKYQCITSLASQLTRCYQPPVVAPHFSAMINP
QAGWNDGSRNHINGLAQVLSADERFSYVQKVTLLCSEVDNRYAADQLDGIFRVSINKSHV
EDMLQKNTLPFDQWITHPSLVDSALLGKLLKDEVIASFPKFTLAECHQINKNPEVIQQII
TKKLSTLSEEKNSALAKIFNTIGHCAKNNDTNAKLNVQSVSISIAPNLFSDECYQTGKEK
QNGKETEMAAFELKEMGKIYVKLFKDWKRMPVPAHFLP
Download sequence
Identical sequences A0A085U4T3
WP_004717823.1.10324 WP_004717823.1.10656 WP_004717823.1.1162 WP_004717823.1.14647 WP_004717823.1.15977 WP_004717823.1.17310 WP_004717823.1.18419 WP_004717823.1.194 WP_004717823.1.19479 WP_004717823.1.22028 WP_004717823.1.2516 WP_004717823.1.29873 WP_004717823.1.31516 WP_004717823.1.33356 WP_004717823.1.35542 WP_004717823.1.3694 WP_004717823.1.36953 WP_004717823.1.37442 WP_004717823.1.44307 WP_004717823.1.4650 WP_004717823.1.49034 WP_004717823.1.49411 WP_004717823.1.51395 WP_004717823.1.51755 WP_004717823.1.52274 WP_004717823.1.61407 WP_004717823.1.61933 WP_004717823.1.64953 WP_004717823.1.70425 WP_004717823.1.7384 WP_004717823.1.75305 WP_004717823.1.76534 WP_004717823.1.80598 WP_004717823.1.81699 WP_004717823.1.82324 WP_004717823.1.82854 WP_004717823.1.83486 WP_004717823.1.84915 WP_004717823.1.85640 WP_004717823.1.87415 WP_004717823.1.90052 WP_004717823.1.94867 WP_004717823.1.96612 WP_004717823.1.97280 WP_004717823.1.99567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]