SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005520381.1.3165 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_005520381.1.3165
Domain Number 1 Region: 105-164
Classification Level Classification E-value
Superfamily alpha-Amylase inhibitor tendamistat 0.00000131
Family alpha-Amylase inhibitor tendamistat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_005520381.1.3165
Sequence length 171
Comment hypothetical protein [Corynebacterium matruchotii]; AA=GCF_000158635.1; RF=na; TAX=566549; STAX=43768; NAME=Corynebacterium matruchotii ATCC 33806; strain=ATCC 33806; AL=Scaffold; RT=Major
Sequence
MAAMKTRILAALLAGVLPISFSMSAPAMAVGKNSEKTTTAAATVVKTDQKTDTDKDKKIT
TVEPGQTKEIELAPGESFRFKEGNSAKITFETDKDLSKDGIKLTRAVAPDCVYAQKEWGF
IQVYNNCGGNEPIRVTVTMAFMPDSECKPVWPGTRTNISPAWGRITGVVLC
Download sequence
Identical sequences C0E1Q9
WP_005520381.1.3165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]