SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005790485.1.85293 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005790485.1.85293
Domain Number - Region: 88-132,174-181
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0353
Family Duffy binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005790485.1.85293
Sequence length 280
Comment MULTISPECIES: hypothetical protein [Bacteroides]; AA=GCF_000273095.1; RF=na; TAX=997878; STAX=817; NAME=Bacteroides fragilis CL03T00C08; strain=CL03T00C08; AL=Scaffold; RT=Major
Sequence
MKKLIVLTCTLSLLTACGDSIEKKAGEKLAAARAAFEHNDYNEAKLQIDSIKILYPKAFD
TRKEGIKLMQQVELKEQQESLVYLDSMLQVKQKEFEAIKNKYTFEKNEEYQKIGNYFWPT
QTVEKNLHRSFLRFQVNEQGVMTLTSIYCGPSNIHHVAVKVIAPDGSFAETPASNDSYET
TDLGEKIEKADYKMGEDGNVLSFLYMNRDKKNIRVEYLGERKFSTTMTPSDREALVGTYE
LAKLLSSIRQIQQEKEEANLKIEFVKRKMEQKAQEEAAEK
Download sequence
Identical sequences A0A015V7A5 A0A016ASC0 A0A016BRZ9 A0A016GCW4 A0A016JH09 A0A0E2AKP0 A0A0E2SSC4 A0A0E2T8R9 A0A1C0X013 D1JUF7 I9VJQ1 Q64Q47
295405.BF3641 WP_005790485.1.10040 WP_005790485.1.100686 WP_005790485.1.10405 WP_005790485.1.18542 WP_005790485.1.21713 WP_005790485.1.22050 WP_005790485.1.23698 WP_005790485.1.26260 WP_005790485.1.26832 WP_005790485.1.32651 WP_005790485.1.33107 WP_005790485.1.34692 WP_005790485.1.35533 WP_005790485.1.39779 WP_005790485.1.44936 WP_005790485.1.456 WP_005790485.1.46679 WP_005790485.1.49748 WP_005790485.1.50677 WP_005790485.1.51373 WP_005790485.1.5142 WP_005790485.1.51489 WP_005790485.1.52936 WP_005790485.1.53995 WP_005790485.1.54019 WP_005790485.1.55270 WP_005790485.1.57121 WP_005790485.1.60699 WP_005790485.1.60854 WP_005790485.1.63108 WP_005790485.1.63590 WP_005790485.1.65921 WP_005790485.1.66858 WP_005790485.1.66941 WP_005790485.1.69826 WP_005790485.1.73957 WP_005790485.1.7580 WP_005790485.1.76253 WP_005790485.1.78347 WP_005790485.1.85293 WP_005790485.1.89499 WP_005790485.1.91045 WP_005790485.1.9461 WP_005790485.1.97349 WP_005790485.1.97964 YP_100918.1.45732 gi|53714926|ref|YP_100918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]