SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_005892525.1.97581 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_005892525.1.97581
Domain Number - Region: 124-160
Classification Level Classification E-value
Superfamily Nucleocapsid protein dimerization domain 0.0262
Family Coronavirus nucleocapsid protein 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_005892525.1.97581
Sequence length 175
Comment TonB system transporter ExbB2 [Aeromonas molluscorum]; AA=GCF_000388115.1; RF=representative genome; TAX=1268236; STAX=271417; NAME=Aeromonas molluscorum 848; strain=848; AL=Contig; RT=Major
Sequence
MWFWLIEEVESIRRFLGMGGDVLVAIFFLTLLMWALLLERWIYFLTVYPQQARGTQHTWL
ARSDHRSWSARQIRRELVSRVALAVDKGMPVIKVLIALCPLMGLLGTVVGMVQVFDTLAI
TGTGSPRAMASGISKATIPTMAGMVASLSGLFFASRLEHKARLAVDKLEDSLKHG
Download sequence
Identical sequences R1FAC5
WP_005892525.1.97581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]