SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006073219.1.87893 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006073219.1.87893
Domain Number - Region: 28-81
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000471
Family Glycerol-3-phosphate transporter 0.059
Further Details:      
 
Domain Number - Region: 94-149
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0102
Family NfeD domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006073219.1.87893
Sequence length 155
Comment membrane protein [Brucella suis]; AA=GCF_000480315.1; RF=na; TAX=1388739; STAX=29461; NAME=Brucella suis 06-988-1656; strain=06-988-1656; AL=Scaffold; RT=Major
Sequence
MIPEFLFQLGIWNWLVFGLILLILEILAPGFFFIWFGLAALVTGALAFLLSSTAGFGWQL
QTVIFLVLAIVFTLAGRRFFGSKSNDTGEPLLNRRGEQLVGQRGTLTEPIVNGHGRIHIN
DTTWRVKGPDLPAGTEIRIVAFDPVSLEIEVGLGE
Download sequence
Identical sequences A9WXE0
WP_006073219.1.100204 WP_006073219.1.101247 WP_006073219.1.1158 WP_006073219.1.11769 WP_006073219.1.13576 WP_006073219.1.2214 WP_006073219.1.23458 WP_006073219.1.24496 WP_006073219.1.44949 WP_006073219.1.49427 WP_006073219.1.62872 WP_006073219.1.66340 WP_006073219.1.72533 WP_006073219.1.77165 WP_006073219.1.77683 WP_006073219.1.81027 WP_006073219.1.83161 WP_006073219.1.86923 WP_006073219.1.87893 WP_006073219.1.90420 470137.BSUIS_B0079 gi|163844273|ref|YP_001621928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]