SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006092547.1.86021 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_006092547.1.86021
Domain Number 1 Region: 2-49
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 3.01e-18
Family Ribosomal protein L39e 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_006092547.1.86021
Sequence length 50
Comment MULTISPECIES: 50S ribosomal protein L39e [Natrialbaceae]; AA=GCF_900108095.1; RF=na; TAX=640943; STAX=640943; NAME=Natronorubrum sediminis; strain=CGMCC 1.8981; AL=Scaffold; RT=Major
Sequence
MGKKTKGKKKRLAKLENQNSRVPAWVMMKTDMEVQRNPKRRNWRRNDTDE
Download sequence
Identical sequences A0A1G9BFP3 A0A1H6G3U5 A0A1N7FU33 L9VHN8 L9X2R5
WP_006092547.1.100590 WP_006092547.1.13145 WP_006092547.1.20059 WP_006092547.1.30935 WP_006092547.1.43173 WP_006092547.1.58059 WP_006092547.1.86021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]