SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006135307.1.69621 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006135307.1.69621
Domain Number - Region: 27-72
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.0191
Family D-aminopeptidase, middle and C-terminal domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006135307.1.69621
Sequence length 94
Comment MULTISPECIES: DUF397 domain-containing protein [Streptomyces]; AA=GCF_002154585.1; RF=na; TAX=36817; STAX=36817; NAME=Streptomyces pseudogriseolus; strain=NRRL B-3288; AL=Scaffold; RT=Major
Sequence
MEFFKPPKTQPRAREHAGRIYNGMPARELGSEGWHKPWSGGNGGNCLEAMKLDDGRIAVR
QSTDPDGPALIYTSAEMTAFIEGAKAGEADFLLS
Download sequence
Identical sequences M3DWS1
WP_006135307.1.39691 WP_006135307.1.43305 WP_006135307.1.45632 WP_006135307.1.69621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]