SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_006275635.1.37856 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_006275635.1.37856
Domain Number - Region: 35-81
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0222
Family Multimerization domain of the phosphoprotein from sendai virus 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_006275635.1.37856
Sequence length 83
Comment MULTISPECIES: twin-arginine translocase TatA/TatE family subunit [Aphanizomenonaceae]; AA=GCF_001858115.1; RF=na; TAX=533243; STAX=77022; NAME=Cylindrospermopsis raciborskii CS-508; strain=CS-508; AL=Contig; RT=Major
Sequence
MNIFGIGLPEMVVIGVVALLIFGPKKLPEIGRSLAKTIRSFQQASSEFQNEFKKEVQQLE
ETIKTTAEIEPKQIESSKEQKHS
Download sequence
Identical sequences A0A0R0MEJ1 A0A1S1ZXJ0 A0A1Z4VIV5 A0A2J8YSS5 A0A2J8YYF8 A0A2J8Z311 A0A2J8ZML0 A0A2J8ZQK1 A0A2J8ZTD8 A0A2J9A4V5 A0A2J9AGT9 A0A2J9APJ2 D4TCI6 D4TUR0
WP_006275635.1.37856 WP_006275635.1.49247 WP_006275635.1.50351 WP_006275635.1.57567 WP_006275635.1.5838 WP_006275635.1.65425 WP_006275635.1.74547 WP_006275635.1.98964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]