SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_007484216.1.54168 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_007484216.1.54168
Domain Number 1 Region: 35-225
Classification Level Classification E-value
Superfamily PG1388-like 1.31e-71
Family PG1388-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_007484216.1.54168
Sequence length 228
Comment hypothetical protein [Bacteroides nordii]; AA=GCF_000613465.1; RF=na; TAX=1203608; STAX=291645; NAME=Bacteroides nordii WAL 11050 = JCM 12987; strain=JCM 12987; AL=Contig; RT=Major
Sequence
MEKIDKWDLVKKRVSLGVFFLGLGLFLFAPLRAQQEAKAVFVSMPDSLSPLLTAVNRADF
IDFLESKMKAKVENRFGGESEMTDLNKDYIRIQMTPQSTWQMKLLAVNDSTQVICTVSTA
CAPACDSSIQFYTTDWKELPLSDFITALPVMNNFLNTPDSASSYEYSEARLQADMLLMKA
DLSATDHTLTFTLATPEYMEKETAEKLKPFIRRPIVYIWKEGGFSIDS
Download sequence
Identical sequences I9S8K9
WP_007484216.1.54168 WP_007484216.1.93978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]