SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008133628.1.30976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_008133628.1.30976
Domain Number 1 Region: 49-166
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 0.0000000837
Family L,D-transpeptidase catalytic domain-like 0.014
Further Details:      
 
Weak hits

Sequence:  WP_008133628.1.30976
Domain Number - Region: 192-219
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 0.0418
Family Ribosomal protein L39e 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_008133628.1.30976
Sequence length 236
Comment MULTISPECIES: hypothetical protein [Pseudoalteromonas]; AA=GCF_000690035.1; RF=na; TAX=579537; STAX=579537; NAME=Pseudoalteromonas sp. S3431; strain=S3431; AL=Contig; RT=Major
Sequence
MKKLITFLVFFMFNSFAAEFPTSARSEKAISMVAPTLKKQLSDKGLEYGAPIFIRIFKDP
GILEVWLESDDGTFIHFKNYEICTFSGDLGPKLKEGDNQSPEGFYYVDASGLNPWSNYHL
SFNLGFPNKYDRTHNRTGSALMVHGNCVSIGCYAMTDEYINEIYALGAAALKSGQSFFRV
HSFPFMLEDEVLSKHKANQWYPFWLNLKEGYDYFNNYKKPPNVEVYKGMYTFENRY
Download sequence
Identical sequences A0A063KN41 G7FXE5
WP_008133628.1.30976 WP_008133628.1.41168 WP_008133628.1.65950 WP_008133628.1.69430 WP_008133628.1.71801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]