SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008589988.1.63272 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008589988.1.63272
Domain Number - Region: 11-51
Classification Level Classification E-value
Superfamily Vanabin-like 0.0131
Family Vanabin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_008589988.1.63272
Sequence length 108
Comment MULTISPECIES: four-helix bundle copper-binding protein [Salimicrobium]; AA=GCF_900107115.1; RF=na; TAX=50717; STAX=50717; NAME=Salimicrobium album; strain=DSM 20748; AL=Scaffold; RT=Major
Sequence
MAEKQYENAMKALHECMEACNYCFDSCLKEDDVKMMAGCIRLDRECADMCGYLEAAISRN
SPYISELASVCAKICDDCAEECAKHDHDHCQKCAEACRKCAEECRKIA
Download sequence
Identical sequences K2GBC4
WP_008589988.1.63272 WP_008589988.1.65787 WP_008589988.1.70646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]