SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_008808248.1.26655 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_008808248.1.26655
Domain Number - Region: 5-94
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000295
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.05
Further Details:      
 
Domain Number - Region: 94-121
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0262
Family Trimerization domain of TRAF 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_008808248.1.26655
Sequence length 164
Comment MULTISPECIES: hypothetical protein [Streptococcus]; AA=GCF_001469295.1; RF=na; TAX=1302; STAX=1302; NAME=Streptococcus gordonii; strain=ATCC 10558; AL=Scaffold; RT=Major
Sequence
MAIEKTVSELAEILGVSRQAINNRVKALPEEDTTKNEKGVTVVTRSGLIKLEEIYKKTIF
EDEPVSEDVKQRELMEILVDEKNAEILRLYDQLKSKDEQLKRKDEQLRIKDVQIAEKDKQ
LDQQQQLTAKAMSERETLLLELDEAKEQVQQQENKGFWARLFGK
Download sequence
Identical sequences A0A0F2CGM7 A0A1E9DS90 A0A1F2G9Y5 D0RSG6
WP_008808248.1.1781 WP_008808248.1.24863 WP_008808248.1.26655 WP_008808248.1.28043 WP_008808248.1.30989 WP_008808248.1.38072 WP_008808248.1.42702 WP_008808248.1.45729 WP_008808248.1.4669 WP_008808248.1.50634 WP_008808248.1.63372 WP_008808248.1.64154 WP_008808248.1.66423 WP_008808248.1.70293 WP_008808248.1.75596 WP_008808248.1.81318 WP_008808248.1.85835 WP_008808248.1.94007 WP_008808248.1.97211 WP_008808248.1.98296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]