SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009126996.1.87028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009126996.1.87028
Domain Number 1 Region: 21-213
Classification Level Classification E-value
Superfamily PG1388-like 2.22e-71
Family PG1388-like 0.0000945
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009126996.1.87028
Sequence length 215
Comment hypothetical protein [Bacteroides fluxus]; AA=GCF_000195635.1; RF=representative genome; TAX=763034; STAX=626930; NAME=Bacteroides fluxus YIT 12057; strain=YIT 12057; AL=Scaffold; RT=Major
Sequence
MIRKMSILLFWIFAGVVASQAQEAKTCFVNMPDSLSPLLSSVNRADFIDFLESKMKAEVT
NNFGGKSEMTELTADYIRVKMSKQSSWQMKLLSVNDSTKVICTVSTVCAPACDSHINFYT
TDWKELASSSYLPALPVINDFIAEAPDTADVYGYQEACLQADMLLMKADLSAKDSRLTFT
FTTPDYMEKEAAEKLKPFLRRPMAYVWKEGRFVAL
Download sequence
Identical sequences F3PYI0
WP_009126996.1.87028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]