SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009292670.1.51763 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009292670.1.51763
Domain Number - Region: 88-132,174-181
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0353
Family Duffy binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009292670.1.51763
Sequence length 280
Comment hypothetical protein [Bacteroides fragilis]; AA=GCF_000598745.1; RF=na; TAX=1339324; STAX=817; NAME=Bacteroides fragilis str. S24L26; strain=S24L26; AL=Contig; RT=Major
Sequence
MKKLIVLTCTLSLLTACGDSIEKKASEKLAAARAAFEHNDYNEAKLQIDSIKILYPKAFD
TRKEGIKLMQQVELKEQQESLVYLDSMLQVKQKEFEAIKNKYTFEKNEEYQKIGNYFWPT
QTVEKNLHRSFLRFQVNEQGVMTLTSIYCGPSNIHHVAVKVIAPDGSFAETPASNDSYET
TDLGEKIEKADYKMGEDGNVLSFLYMNRDKKNIRVEYLGERKFSTTMTPSDREALVGTYE
LAKLLSSIRQIQQEKEEANLKIEFVKRKMEQKAQEEAAEK
Download sequence
Identical sequences F7LSZ0
WP_009292670.1.51763 WP_009292670.1.93759 WP_009292670.1.98903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]