SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009317474.1.83878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009317474.1.83878
Domain Number - Region: 22-84
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0942
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009317474.1.83878
Sequence length 91
Comment hypothetical protein [Tannerella sp. 6_1_58FAA_CT1]; AA=GCF_000238695.1; RF=na; TAX=665949; STAX=665949; NAME=Tannerella sp. 6_1_58FAA_CT1; strain=6_1_58FAA_CT1; AL=Scaffold; RT=Major
Sequence
MDNIKESKEYRLAKDWEMAVNDYGFNPKRFAAAIPDMHPTLQQGLYRLIRECIKVMADDS
RRYDDRNRASHEEAKCIMEYLNEHGKHIPLK
Download sequence
Identical sequences G9S2N1
WP_009317474.1.83878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]