SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009329404.1.8660 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009329404.1.8660
Domain Number - Region: 39-99
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0183
Family VPS28 N-terminal domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_009329404.1.8660
Sequence length 119
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_001925025.1; RF=na; TAX=1402; STAX=1402; NAME=Bacillus licheniformis; strain=B4089; AL=Scaffold; RT=Major
Sequence
MGEEFEKRYLHWIDEAVKESEKKDDFKSLPGYGKPLNKEMLEGDALSSTLKNARYLPEWL
KLQKEIKQEIEKAIKSNQRETLIDAINQKIKKYNLTCPNQFQKGLVSAKNLESQLKYWS
Download sequence
Identical sequences T5HCU4
WP_009329404.1.30581 WP_009329404.1.35726 WP_009329404.1.55910 WP_009329404.1.64701 WP_009329404.1.85389 WP_009329404.1.8660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]