SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009366132.1.5818 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009366132.1.5818
Domain Number 1 Region: 80-152
Classification Level Classification E-value
Superfamily PUA domain-like 3.92e-20
Family PUA domain 0.0014
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.0000000000000196
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009366132.1.5818
Sequence length 157
Comment PUA domain containing protein [Halogranum salarium]; AA=GCF_000283335.1; RF=representative genome; TAX=1210908; STAX=693851; NAME=Halogranum salarium B-1; strain=B-1; AL=Contig; RT=Major
Sequence
MSDAEDLADLRIIADYQFGADAGDVLFPADEELRVSRSTSGRPRQIHAGDDRLVSYGTDG
RFTLGLAGGSRLVAAGESPANRVVVGDESEPFVRDGKNVFAKFVDTVDPAVRPGDEVAIV
HEDGDVLGVGRAELSADAIVDFQSGMAVKVREGAGEK
Download sequence
Identical sequences J2ZI74
WP_009366132.1.5818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]