SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009484837.1.57662 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_009484837.1.57662
Domain Number - Region: 11-58
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0687
Family VPS28 N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_009484837.1.57662
Sequence length 75
Comment MULTISPECIES: hypothetical protein [Klebsiella]; AA=GCF_900093035.1; RF=na; TAX=573; STAX=573; NAME=Klebsiella pneumoniae; strain=PB506; AL=Scaffold; RT=Major
Sequence
MTPSNTYLTVSLTHPEKVTSENLAELYRDWMNNYLSVSAFAEDYGITVPQAEMTIAKGRM
VHEAAAEWLKEFNKA
Download sequence
Identical sequences A0A2J2LHL6
WP_009484837.1.100268 WP_009484837.1.10194 WP_009484837.1.12522 WP_009484837.1.23642 WP_009484837.1.2447 WP_009484837.1.24590 WP_009484837.1.35699 WP_009484837.1.55515 WP_009484837.1.5576 WP_009484837.1.57662 WP_009484837.1.64852 WP_009484837.1.84553 WP_009484837.1.87591 WP_009484837.1.93518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]