SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_009989670.1.57434 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_009989670.1.57434
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily Pre-PUA domain 1.11e-21
Family Hypothetical protein Ta1423, N-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 68-150
Classification Level Classification E-value
Superfamily PUA domain-like 8.29e-18
Family PUA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_009989670.1.57434
Sequence length 152
Comment RNA-binding protein [Sulfolobus solfataricus]; AA=GCF_000175555.1; RF=na; TAX=555311; STAX=2287; NAME=Sulfolobus solfataricus 98/2; strain=98/2; AL=Contig; RT=Major
Sequence
MQRHVMSSKDSKIFINKIKEKYNVDISNAKLEVGKEKKEIWYYVNDILAFFDDLIPTLCA
IIRLKINLPYVIIDEGAVKAVSKGADLFAPGIVEYNCECKENEIVLAKTKTNLPVAVLRV
LMPKEKALVEKKGKFALNLHHIGDKIWEMCNG
Download sequence
Identical sequences A0A0E3K094 D0KR48 Q97TZ1
gi|384433460|ref|YP_005642818.1| 354002 gi|15899938|ref|NP_344543.1| 273057.SSO3240 WP_009989670.1.14611 WP_009989670.1.22626 WP_009989670.1.43719 WP_009989670.1.57434 WP_009989670.1.66040 WP_009989670.1.8449 WP_009989670.1.93834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]