SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010477181.1.73803 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_010477181.1.73803
Domain Number 1 Region: 4-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.15e-19
Family Ribosomal protein L39e 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_010477181.1.73803
Sequence length 51
Comment MULTISPECIES: 50S ribosomal protein L39e [Thermococcus]; AA=GCF_000258515.1; RF=representative genome; TAX=1151117; STAX=54076; NAME=Thermococcus zilligii AN1; strain=AN1; AL=Contig; RT=Major
Sequence
MARNKPLAKKLRLAKAAKQNRRVPVWVIVKTNRKVMTHPKRRHWRRTKLKE
Download sequence
Identical sequences B7R1Y2 C5A7H4
gi|240103741|ref|YP_002960050.1| 593117.TGAM_1684 gi|223478183|ref|YP_002582734.1| WP_010477181.1.59639 WP_010477181.1.60195 WP_010477181.1.73803 WP_010477181.1.92279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]