SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_010968586.1.787 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_010968586.1.787
Domain Number - Region: 64-85
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 0.0191
Family D-aminopeptidase, middle and C-terminal domains 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_010968586.1.787
Sequence length 205
Comment hypothetical protein [Sinorhizobium meliloti]; AA=GCF_000346065.1; RF=na; TAX=1286640; STAX=382; NAME=Sinorhizobium meliloti 2011; strain=2011; AL=Complete Genome; RT=Major
Sequence
MNRIEKLPPAFERFDEMLGVLDFAIFEDAGGTEEEILSAVPQALRHFHRFDAGKLRALGS
RRICEKAFFGDWYDPDSGSLLRLGSYKTADGSQLTDPVLSSLDDVRIMSGASSCPEPGGQ
FAYAFSHPPYPLNARPGEVQAVFEEIRDFILPPLHRSEILDWSDARLPEVSDYFEDGAEW
WGVFLFSVHIPSMRRLTIIAGSTTD
Download sequence
Identical sequences A0A0E0U8U4 A0A222L942 Q92SE7
gi|470187407|ref|YP_007573718.1| 266834.SMc01713 gi|433612238|ref|YP_007189036.1| gi|384528191|ref|YP_005712279.1| NP_384559.1.96377 WP_010968586.1.22199 WP_010968586.1.24285 WP_010968586.1.36834 WP_010968586.1.4234 WP_010968586.1.47143 WP_010968586.1.55094 WP_010968586.1.58221 WP_010968586.1.58608 WP_010968586.1.63001 WP_010968586.1.72343 WP_010968586.1.73540 WP_010968586.1.787 WP_010968586.1.79107 WP_010968586.1.83536 WP_010968586.1.86220 WP_010968586.1.89614 WP_010968586.1.90561 WP_010968586.1.90968 WP_010968586.1.92524 WP_010968586.1.94084 gi|15964206|ref|NP_384559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]