SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011024005.1.60556 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011024005.1.60556
Domain Number 1 Region: 3-49
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.7e-17
Family Ribosomal protein L39e 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011024005.1.60556
Sequence length 51
Comment MULTISPECIES: 50S ribosomal protein L39 [Methanosarcina]; AA=GCF_000979475.1; RF=na; TAX=1483598; STAX=1483598; NAME=Methanosarcina sp. 2.H.T.1A.8; strain=2.H.T.1A.8; AL=Scaffold; RT=Major
Sequence
MSHNMKGQKKRLAKAHKQNTRVPVWVIVKTNRKVVSHPRRRHWRRRSLDVK
Download sequence
Identical sequences A0A1E7G8P3 Q8TIN2
gi|20092907|ref|NP_618982.1| WP_011024005.1.11460 WP_011024005.1.35842 WP_011024005.1.43275 WP_011024005.1.50979 WP_011024005.1.60556 WP_011024005.1.68146 WP_011024005.1.72848 WP_011024005.1.78801 WP_011024005.1.96639 WP_011024005.1.98848 188937.MA4114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]