SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011178157.1.10384 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011178157.1.10384
Domain Number 1 Region: 196-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000000000000352
Family Homoserine kinase 0.052
Further Details:      
 
Domain Number 2 Region: 6-171
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000000114
Family GHMP Kinase, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011178157.1.10384
Sequence length 324
Comment diphosphomevalonate decarboxylase [Picrophilus torridus]; AA=GCF_000008265.1; RF=representative genome; TAX=263820; STAX=82076; NAME=Picrophilus torridus DSM 9790; strain=DSM 9790; AL=Complete Genome; RT=Major
Sequence
MENYNVKTRAFPTIGIILLGGISDKKNRIPLHTTAGIAYTGINNDVYTETKLYVSKDEKC
YIDGKEIDLNSDRSPSKVIDKFKHEILMRVNLDDENNLSIDSRNFNILSGSSDSGAAALG
ECIESIFEYNINIFTFENDLQRISESVGRSLYGGLTVNYANGRESLTEPLLEPEAFNNFT
IIGAHFNIDRKPSNEIHENIIKHENYRERIKSAERKAKKLEELSRNANIKGIFELAESDT
VEYHKMLHDVGVDIINDRMENLIERVKEMKNNFWNSYIVTGGPNVFVITEKKDVDKAMEG
LNDLCDDIRLLKVAGKPQVISKNF
Download sequence
Identical sequences Q6KZB1
263820.PTO1356 gi|48478428|ref|YP_024134.1| WP_011178157.1.10384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]