SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011229640.1.2219 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011229640.1.2219
Domain Number 1 Region: 1-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-45
Family Nucleotide and nucleoside kinases 0.000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011229640.1.2219
Sequence length 217
Comment adenylate kinase [Geobacillus kaustophilus]; AA=GCF_000009785.1; RF=na; TAX=235909; STAX=1462; NAME=Geobacillus kaustophilus HTA426; strain=HTA426; AL=Complete Genome; RT=Major
Sequence
MNLVLMGLPGAGKGTQAGKIVEAYGIPHISTGDMFRAAIKEGTPLGLQAKQYMDRGDLVP
DEVTIGIVRERLSKEDCQHGFLLDGFPRTVAQAEALETLLSEIGRKLDYVIHIDVRQEVL
MERLTGRRICRNCGATYHLVFHPPAKPGVCDKCGGDLYQRPDDNEATVANRLEVNMKQMK
PLLDFYEQKGYLRHINGEQEMEKVFADICEVLGGLAR
Download sequence
Identical sequences Q5L3R8
235909.GK0127 gi|56418662|ref|YP_145980.1| WP_011229640.1.2219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]